PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DS_469ED3135.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 324aa    MW: 35983.5 Da    PI: 6.7371
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DS_469ED3135.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.11e-181461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WTteEde+l  +++++G g+W++ ++  g++R++k+c++rw +yl
  Traes_7DS_469ED3135.1 14 KGPWTTEEDEKLMSYIQKHGHGSWRALPQLAGLNRCGKSCRLRWTNYL 61
                           79********************************************97 PP

2Myb_DNA-binding591.1e-1867112148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++++eE++ ++++++ lG++ W++Ia++++ gRt++++k++w+++l
  Traes_7DS_469ED3135.1  67 RGKFSQEEEQTILQLHTILGNK-WSAIAKHLP-GRTDNEIKNFWNTHL 112
                            89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.581961IPR017930Myb domain
SuperFamilySSF466893.26E-3211108IPR009057Homeodomain-like
SMARTSM007173.6E-141363IPR001005SANT/Myb domain
PfamPF002493.0E-171461IPR001005SANT/Myb domain
CDDcd001673.06E-111661No hitNo description
PROSITE profilePS5129427.53462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-2865117IPR009057Homeodomain-like
SMARTSM007173.5E-1766114IPR001005SANT/Myb domain
PfamPF002498.7E-1767112IPR001005SANT/Myb domain
CDDcd001672.16E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRPPSSDEN GLKKGPWTTE EDEKLMSYIQ KHGHGSWRAL PQLAGLNRCG KSCRLRWTNY  60
LKPDIKRGKF SQEEEQTILQ LHTILGNKWS AIAKHLPGRT DNEIKNFWNT HLRKKLIKMG  120
IDPMTHRPRT DFFAALPQLI ALANLRQFIT QQPLDDHTAR LQAQTAQAAN LQYVQSLLHS  180
AASVAASPTT SSSLNSLTMD LEQINFLSPP QMLSPSVLEG IDGIDLAGQV SQNQMPSVTF  240
DHTIGNINPG SHNNVETSEK HRSEGENSSQ KRSFLSENSL PPLTDMAASN ICNTISTSNC  300
DGVSSPFPSW SEILLDEELL CEFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-30121162105C-Myb DNA-Binding Domain
1msf_C1e-30121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP3304810.0KP330481.1 Triticum aestivum MYB transcription factor SM152-2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560902.10.0PREDICTED: myb-related protein Hv1-like
TrEMBLW5I6T70.0W5I6T7_WHEAT; MYB transcription factor SM152-2
TrEMBLN1QVR20.0N1QVR2_AEGTA; Transcription factor MYB39
STRINGMLOC_51960.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.17e-92myb domain protein 93
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]